Recombinant Human ATP synthase subunit O, mitochondrial (ATP5PO)

In Stock
Code CSB-EP002379HU
MSDS
Size $224
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
Greater than 90% as determined by SDS-PAGE.
Target Names
ATP5PO
Uniprot No.
Research Area
Metabolism
Alternative Names
ATP synthase O subunit mitochondrial precursor; ATP synthase subunit O; ATP synthase; H+ transporting; mitochondrial F1 complex; O subunit; ATP5O; ATPO; ATPO_HUMAN; mitochondrial; Mitochondrial ATP synthase; O subunit ; Oligomycin sensitivity conferral protein; OSCP
Species
Homo sapiens (Human)
Source
E.coli
Expression Region
24-213aa
Target Protein Sequence
FAKLVRPPVQVYGIEGRYATALYSAASKQNKLEQVEKELLRVAQILKEPKVAASVLNPYVKRSIKVKSLNDITAKERFSPLTTNLINLLAENGRLSNTQGVVSAFSTMMSVHRGEVPCTVTSASPLEEATLSELKTVLKSFLSQGQVLKLEAKTDPSILGGMIVRIGEKYVDMSVKTKIQKLGRAMREIV
Note: The complete sequence including tag sequence, target protein sequence and linker sequence could be provided upon request.
Mol. Weight
47.9kDa
Protein Length
Full Length of Mature Protein
Tag Info
N-terminal GST-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description

Amino acids 24-213 constitute the expression domain of recombinant Human ATP5O. This ATP5O protein is expected to have a theoretical molecular weight of 47.9 kDa. This protein is generated in a e.coli-based system. The N-terminal GST tag was fused into the coding gene segment of ATP5O, making it easier to detect and purify the ATP5O recombinant protein in the later stages of expression and purification.

The research on ATP synthase subunit O, mitochondrial (ATP5PO) covers the fields of cell biology, mitochondrial biology, and diseases related to metabolism. ATP5PO is a subunit within the mitochondria, belonging to the ATP synthase complex. One of the prominent areas of study is its crucial role in cellular energy production. Researchers focus on the role of ATP5PO in the mitochondrial respiratory chain, particularly its involvement in the formation of the ATP synthase complex and the mechanisms of catalytic reactions. Additionally, ATP5PO is associated with the pathogenesis of many diseases, especially those related to mitochondrial dysfunction and disruptions in cellular energy metabolism. Research on these diseases contributes to uncovering their causes and providing potential targets for future treatments.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Mitochondrial membrane ATP synthase (F(1)F(0) ATP synthase or Complex V) produces ATP from ADP in the presence of a proton gradient across the membrane which is generated by electron transport complexes of the respiratory chain. F-type ATPases consist of two structural domains, F(1) - containing the extramembraneous catalytic core and F(0) - containing the membrane proton channel, linked together by a central stalk and a peripheral stalk. During catalysis, ATP synthesis in the catalytic domain of F(1) is coupled via a rotary mechanism of the central stalk subunits to proton translocation. Part of the complex F(0) domain and the peripheric stalk, which acts as a stator to hold the catalytic alpha(3)beta(3) subcomplex and subunit a/ATP6 static relative to the rotary elements.
Gene References into Functions
  1. Upon IF1 interaction with the ATP synthase both the synthetic and hydrolytic activities of the engine of oxidative phosphorylation are inhibited. (Review) PMID: 26876430
  2. Sirt3 physically interacted with the OSCP and led to its subsequent deacetylation. PMID: 23046812
  3. Human mitochondrial F(1)F(0) ATP synthase was isolated with a one-step immunological approach. PMID: 12110673
  4. Genetic variation and age are associated with skeletal muscle ATP5O mRNA expression and glucose disposal rate, suggesting that combinations of genetic and non-genetic factors may cause the reduced expression of ATP5O in type 2 diabetes muscle PMID: 19274082
Subcellular Location
Mitochondrion. Mitochondrion inner membrane.
Protein Families
ATPase delta chain family
Database Links

HGNC: 850

OMIM: 600828

KEGG: hsa:539

STRING: 9606.ENSP00000290299

UniGene: Hs.409140

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2024 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*